Class g: Small proteins [56992] (72 folds) |
Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily) |
Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families) conserved core consists of a helix and a loop crosslinked with two disulfides |
Family g.68.1.1: Ovomucoid domain III-like [57468] (10 proteins) |
Protein Domain of BM-40/SPARC/osteonectin [57478] (1 species) the C-terminal part of FS module |
Species Human (Homo sapiens) [TaxId:9606] [57479] (2 PDB entries) |
Domain d1nubb3: 1nub B:78-135 [44716] Other proteins in same PDB: d1nuba1, d1nuba2, d1nubb1, d1nubb2 complexed with ca, nag; mutant |
PDB Entry: 1nub (more details), 2.8 Å
SCOP Domain Sequences for d1nubb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nubb3 g.68.1.1 (B:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens)} cqdptscpapigefekvcsndnktfdsschffatkctlegtkkghklhldyigpckyi
Timeline for d1nubb3: