SCOPe 2.08: Domain d1nubb3: 1nub B:78-135

Lineage for d1nubb3 (1nub B:78-135)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)

4. Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families)
   conserved core consists of a helix and a loop crosslinked with two disulfides

5. Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)

6. Protein Domain of BM-40/SPARC/osteonectin [57478] (1 species)
   the C-terminal part of FS module

7. Species Human (Homo sapiens) [TaxId:9606] [57479] (2 PDB entries)

8. Domain d1nubb3: 1nub B:78-135 [44716]
   Other proteins in same PDB: d1nuba1, d1nuba2, d1nubb1, d1nubb2
   complexed with ca; mutant

Details for d1nubb3

PDB Entry: 1nub, 2.8 Å

PDB Description: helix c deletion mutant of bm-40 fs-ec domain pair

PDB Compounds: (B:) basement membrane protein bm-40

SCOPe Domain Sequences for d1nubb3:

Sequence; same for both SEQRES and ATOM records:

>d1nubb3 g.68.1.1 (B:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]}
cqdptscpapigefekvcsndnktfdsschffatkctlegtkkghklhldyigpckyi

Timeline for d1nubb3:

• d1nubb3 first appeared (with stable ids) in SCOP 1.55
  
• d1nubb3 appears in SCOPe 2.07