SCOP 1.73: Domain d1nuba3: 1nub A:78-135

Lineage for d1nuba3 (1nub A:78-135)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)

4. Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families)
   conserved core consists of a helix and a loop crosslinked with two disulfides

5. Family g.68.1.1: Ovomucoid domain III-like [57468] (10 proteins)

6. Protein Domain of BM-40/SPARC/osteonectin [57478] (1 species)
   the C-terminal part of FS module

7. Species Human (Homo sapiens) [TaxId:9606] [57479] (2 PDB entries)

8. Domain d1nuba3: 1nub A:78-135 [44715]
   Other proteins in same PDB: d1nuba1, d1nuba2, d1nubb1, d1nubb2

Details for d1nuba3

PDB Entry: 1nub, 2.8 Å

PDB Description: helix c deletion mutant of bm-40 fs-ec domain pair

PDB Compounds: (A:) basement membrane protein bm-40

SCOP Domain Sequences for d1nuba3:

Sequence; same for both SEQRES and ATOM records:

>d1nuba3 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]}
cqdptscpapigefekvcsndnktfdsschffatkctlegtkkghklhldyigpckyi

Timeline for d1nuba3:

• d1nuba3 first appeared (with stable ids) in SCOP 1.55
  
• d1nuba3 appears in SCOP 1.71
  
• d1nuba3 appears in SCOP 1.75
  
• d1nuba3 appears in the current release, SCOPe 2.08