SCOP 1.73: Domain d1nubb1: 1nub B:136-286

Lineage for d1nubb1 (1nub B:136-286)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.3: Osteonectin [47489] (1 protein)
   5 helices; two EF-hands plus one of additional helices in the N-terminal part

6. Protein C-terminal (EC) domain of BM-40/SPARC/osteonectin [47490] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47491] (3 PDB entries)

8. Domain d1nubb1: 1nub B:136-286 [17192]
   Other proteins in same PDB: d1nuba2, d1nuba3, d1nubb2, d1nubb3
   complexed with ca, nag; mutant

Details for d1nubb1

PDB Entry: 1nub, 2.8 Å

PDB Description: helix c deletion mutant of bm-40 fs-ec domain pair

PDB Compounds: (B:) basement membrane protein bm-40

SCOP Domain Sequences for d1nubb1:

Sequence; same for both SEQRES and ATOM records:

>d1nubb1 a.39.1.3 (B:136-286) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]}
ppcldseltefplrmrdwlknvlvtlyerdednnlltekqklrvkkihenekrleagdhp
eknynmyifpvhwqfgqldqhpidgylshtelaplraplipmehcttrffetcdldndky
ialdewagcfgikqkdidkdlvi

Timeline for d1nubb1:

• d1nubb1 first appeared (with stable ids) in SCOP 1.55
  
• d1nubb1 appears in SCOP 1.71
  
• d1nubb1 appears in SCOP 1.75
  
• d1nubb1 appears in the current release, SCOPe 2.08