![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily) |
![]() | Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families) ![]() conserved core consists of a helix and a loop crosslinked with two disulfides |
![]() | Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins) |
![]() | Protein Secretory trypsin inhibitor [57473] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57474] (3 PDB entries) |
![]() | Domain d1hpta_: 1hpt A: [44703] |
PDB Entry: 1hpt (more details), 2.3 Å
SCOPe Domain Sequences for d1hpta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hpta_ g.68.1.1 (A:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]} dslgreakcynelngctyeyrpvcgtdgdtypnecvlcfenrkrqtsiliqksgpc
Timeline for d1hpta_: