Lineage for d1hpta_ (1hpt A:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1465700Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 1465701Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 1465702Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)
  6. 1465791Protein Secretory trypsin inhibitor [57473] (2 species)
  7. 1465792Species Human (Homo sapiens) [TaxId:9606] [57474] (3 PDB entries)
  8. 1465793Domain d1hpta_: 1hpt A: [44703]

Details for d1hpta_

PDB Entry: 1hpt (more details), 2.3 Å

PDB Description: three-dimensional structure of a recombinant variant of human pancreatic secretory trypsin inhibitor (kazal type)
PDB Compounds: (A:) pancreatic secretory trypsin inhibitor (kazal type) variant 3

SCOPe Domain Sequences for d1hpta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hpta_ g.68.1.1 (A:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]}
dslgreakcynelngctyeyrpvcgtdgdtypnecvlcfenrkrqtsiliqksgpc

SCOPe Domain Coordinates for d1hpta_:

Click to download the PDB-style file with coordinates for d1hpta_.
(The format of our PDB-style files is described here.)

Timeline for d1hpta_: