Lineage for d1hpt__ (1hpt -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40708Fold g.15: Ovomucoid/PCI-1 like inhibitors [57466] (1 superfamily)
  4. 40709Superfamily g.15.1: Ovomucoid/PCI-1 like inhibitors [57467] (2 families) (S)
  5. 40710Family g.15.1.1: Animal Kazal-type inhibitors [57468] (7 proteins)
  6. 40763Protein Secretory trypsin inhibitor [57473] (2 species)
  7. 40764Species Human (Homo sapiens) [TaxId:9606] [57474] (3 PDB entries)
  8. 40765Domain d1hpt__: 1hpt - [44703]

Details for d1hpt__

PDB Entry: 1hpt (more details), 2.3 Å

PDB Description: three-dimensional structure of a recombinant variant of human pancreatic secretory trypsin inhibitor (kazal type)

SCOP Domain Sequences for d1hpt__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hpt__ g.15.1.1 (-) Secretory trypsin inhibitor {Human (Homo sapiens)}
dslgreakcynelngctyeyrpvcgtdgdtypnecvlcfenrkrqtsiliqksgpc

SCOP Domain Coordinates for d1hpt__:

Click to download the PDB-style file with coordinates for d1hpt__.
(The format of our PDB-style files is described here.)

Timeline for d1hpt__: