Lineage for d2sgpi_ (2sgp I:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 89650Fold g.15: Ovomucoid/PCI-1 like inhibitors [57466] (1 superfamily)
  4. 89651Superfamily g.15.1: Ovomucoid/PCI-1 like inhibitors [57467] (2 families) (S)
  5. 89652Family g.15.1.1: Animal Kazal-type inhibitors [57468] (7 proteins)
  6. 89663Protein Ovomucoid III domain [57469] (3 species)
  7. 89673Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (18 PDB entries)
  8. 89685Domain d2sgpi_: 2sgp I: [44689]
    Other proteins in same PDB: d2sgpe_

Details for d2sgpi_

PDB Entry: 2sgp (more details), 1.8 Å

PDB Description: pro 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5

SCOP Domain Sequences for d2sgpi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2sgpi_ g.15.1.1 (I:) Ovomucoid III domain {Turkey (Meleagris gallopavo)}
vdcseypkpactpeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc

SCOP Domain Coordinates for d2sgpi_:

Click to download the PDB-style file with coordinates for d2sgpi_.
(The format of our PDB-style files is described here.)

Timeline for d2sgpi_: