SCOP 1.69: Domain d1ct2i_: 1ct2 I:

Lineage for d1ct2i_ (1ct2 I:)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)

4. Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families)
   conserved core consists of a helix and a loop crosslinked with two disulfides

5. Family g.68.1.1: Ovomucoid domain III-like [57468] (10 proteins)

6. Protein Ovomucoid domains [57469] (3 species)
   unless specified in the comment, the listed structures are of domain III

7. Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (31 PDB entries)

8. Domain d1ct2i_: 1ct2 I: [44683]
   Other proteins in same PDB: d1ct2e_

Details for d1ct2i_

PDB Entry: 1ct2, 1.65 Å

PDB Description: crystal structure of the omtky3 p1 variant omtky3-thr18i in complex with sgpb

SCOP Domain Sequences for d1ct2i_:

Sequence; same for both SEQRES and ATOM records:

>d1ct2i_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo)}
vdcseypkpactteyrplcgsdnktygnkcnfcnavvesngtltlshfgkc

Timeline for d1ct2i_:

• d1ct2i_ first appeared (with stable ids) in SCOP 1.55
  
• d1ct2i_ appears in SCOP 1.67
  
• d1ct2i_ appears in SCOP 1.71
  
• d1ct2i_ appears in the current release, SCOPe 2.08