Lineage for d1qo6a1 (1qo6 A:42-101)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1063790Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 1063791Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 1063888Family g.14.1.2: Fibronectin type II module [57459] (4 proteins)
    shorter two-disulfide version of a kringle module
  6. 1063889Protein Fibronectin [57462] (1 species)
  7. 1063890Species Human (Homo sapiens) [TaxId:9606] [57463] (4 PDB entries)
  8. 1063896Domain d1qo6a1: 1qo6 A:42-101 [44673]
    Other proteins in same PDB: d1qo6a2

Details for d1qo6a1

PDB Entry: 1qo6 (more details)

PDB Description: solution structure of a pair of modules from the gelatin-binding domain of fibronectin
PDB Compounds: (A:) Fibronectin

SCOPe Domain Sequences for d1qo6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qo6a1 g.14.1.2 (A:42-101) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
avtqtyggnsngepcvlpftyngrtfyscttegrqdghlwcsttsnyeqdqkysfctdht

SCOPe Domain Coordinates for d1qo6a1:

Click to download the PDB-style file with coordinates for d1qo6a1.
(The format of our PDB-style files is described here.)

Timeline for d1qo6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qo6a2