Lineage for d1e8ba1 (1e8b A:42-101)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 270198Fold g.14: Kringle-like [57439] (1 superfamily)
    disulphide-rich fold; nearly all-beta
  4. 270199Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 270275Family g.14.1.2: Fibronectin type II module [57459] (4 proteins)
    shorter two-disulfide version of a kringle module
  6. 270276Protein Fibronectin [57462] (1 species)
  7. 270277Species Human (Homo sapiens) [TaxId:9606] [57463] (4 PDB entries)
  8. 270282Domain d1e8ba1: 1e8b A:42-101 [44671]
    Other proteins in same PDB: d1e8ba3

Details for d1e8ba1

PDB Entry: 1e8b (more details)

PDB Description: solution structure of 6f11f22f2, a compact three-module fragment of the gelatin-binding domain of human fibronectin

SCOP Domain Sequences for d1e8ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8ba1 g.14.1.2 (A:42-101) Fibronectin {Human (Homo sapiens)}
avtqtyggnsngepcvlpftyngrtfyscttegrqdghlwcsttsnyeqdqkysfctdht

SCOP Domain Coordinates for d1e8ba1:

Click to download the PDB-style file with coordinates for d1e8ba1.
(The format of our PDB-style files is described here.)

Timeline for d1e8ba1: