Lineage for d2pk4a_ (2pk4 A:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 748907Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 748908Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 748909Family g.14.1.1: Kringle modules [57441] (6 proteins)
  6. 748946Protein Plasminogen [63400] (1 species)
  7. 748947Species Human (Homo sapiens) [TaxId:9606] [63401] (18 PDB entries)
  8. 748960Domain d2pk4a_: 2pk4 A: [44631]
    kringle 4
    complexed with aca

Details for d2pk4a_

PDB Entry: 2pk4 (more details), 2.25 Å

PDB Description: the refined structure of the epsilon-aminocaproic acid complex of human plasminogen kringle
PDB Compounds: (A:) human plasminogen kringle 4

SCOP Domain Sequences for d2pk4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pk4a_ g.14.1.1 (A:) Plasminogen {Human (Homo sapiens) [TaxId: 9606]}
qdcyhgdgqsyrgtssttttgkkcqswssmtphrhqktpenypnagltmnycrnpdadkg
pwcfttdpsvrweycnlkkc

SCOP Domain Coordinates for d2pk4a_:

Click to download the PDB-style file with coordinates for d2pk4a_.
(The format of our PDB-style files is described here.)

Timeline for d2pk4a_: