PDB entry 2pk4

View 2pk4 on RCSB PDB site
Description: the refined structure of the epsilon-aminocaproic acid complex of human plasminogen kringle
Class: hydrolase(serine protease)
Keywords: hydrolase(serine protease)
Deposited on 1991-07-18, released 1993-10-31
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2.25 Å
R-factor: 0.148
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: human plasminogen kringle 4
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00747 (0-79)
  Domains in SCOP 1.73: d2pk4a_
• Heterogens: ACA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pk4A (A:)
  qdcyhgdgqsyrgtssttttgkkcqswssmtphrhqktpenypnagltmnycrnpdadkg
  pwcfttdpsvrweycnlkkc