Lineage for d2pk4__ (2pk4 -)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 89571Fold g.14: Kringle-like [57439] (1 superfamily)
  4. 89572Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 89573Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 89605Protein Plasminogen kringles [63400] (1 species)
  7. 89606Species Human (Homo sapiens) [TaxId:9606] [63401] (9 PDB entries)
  8. 89609Domain d2pk4__: 2pk4 - [44631]

Details for d2pk4__

PDB Entry: 2pk4 (more details), 2.25 Å

PDB Description: the refined structure of the epsilon-aminocaproic acid complex of human plasminogen kringle

SCOP Domain Sequences for d2pk4__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pk4__ g.14.1.1 (-) Plasminogen kringles {Human (Homo sapiens)}
qdcyhgdgqsyrgtssttttgkkcqswssmtphrhqktpenypnagltmnycrnpdadkg
pwcfttdpsvrweycnlkkc

SCOP Domain Coordinates for d2pk4__:

Click to download the PDB-style file with coordinates for d2pk4__.
(The format of our PDB-style files is described here.)

Timeline for d2pk4__: