PDB entry 2pk4

View 2pk4 on RCSB PDB site
Description: the refined structure of the epsilon-aminocaproic acid complex of human plasminogen kringle
Deposited on 1991-07-18, released 1993-10-31
The last revision prior to the SCOP 1.57 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.25 Å
R-factor: 0.148
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d2pk4__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pk4_ (-)
  qdcyhgdgqsyrgtssttttgkkcqswssmtphrhqktpenypnagltmnycrnpdadkg
  pwcfttdpsvrweycnlkkc