SCOP 1.63: Domain d2hgf__: 2hgf -

Lineage for d2hgf__ (2hgf -)

1. Root: SCOP 1.63

2. Class g: Small proteins [56992] (61 folds)

3. Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
   alpha+beta fold with two crossing loops

4. Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families)
   the middle part is structurally similar to some knottins and defensins but differs in the disulphide pattern

5. Family g.10.1.1: Hairpin loop containing domain [57415] (1 protein)

6. Protein Hepatocyte growth factor [57416] (1 species)
   heparin-binding domain

7. Species Human (Homo sapiens) [TaxId:9606] [57417] (6 PDB entries)

8. Domain d2hgf__: 2hgf - [44607]

Details for d2hgf__

PDB Entry: 2hgf

PDB Description: hairpin loop containing domain of hepatocyte growth factor, nmr, minimized average structure

SCOP Domain Sequences for d2hgf__:

Sequence; same for both SEQRES and ATOM records:

>d2hgf__ g.10.1.1 (-) Hepatocyte growth factor {Human (Homo sapiens)}
gqrkrrntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfd
karkqclwfpfnsmssgvkkefghefdlyenkdyirn

Timeline for d2hgf__:

• d2hgf__ first appeared (with stable ids) in SCOP 1.55
  
• d2hgf__ appears in SCOP 1.61
  
• d2hgf__ appears in SCOP 1.65
  
• d2hgf__ appears in the current release, SCOPe 2.08, called d2hgfa_