Lineage for d2knt__ (2knt -)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 89306Fold g.8: BPTI-like [57361] (1 superfamily)
  4. 89307Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 89308Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)
  6. 89330Protein Collagen type VI (domain C5 from alpha 3 chain) [57366] (1 species)
  7. 89331Species Human (Homo sapiens) [TaxId:9606] [57367] (3 PDB entries)
  8. 89332Domain d2knt__: 2knt - [44537]

Details for d2knt__

PDB Entry: 2knt (more details), 1.2 Å

PDB Description: the 1.2 angstrom structure of kunitz type domain c5

SCOP Domain Sequences for d2knt__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2knt__ g.8.1.1 (-) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens)}
etdicklpkdegtcrdfilkwyydpntkscarfwyggcggnenkfgsqkecekvcapv

SCOP Domain Coordinates for d2knt__:

Click to download the PDB-style file with coordinates for d2knt__.
(The format of our PDB-style files is described here.)

Timeline for d2knt__: