Lineage for d2knt__ (2knt -)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.8: BPTI-like [57361] (1 superfamily) Superfamily g.8.1: BPTI-like [57362] (2 families) 
Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins) 
Protein Collagen type VI (domain C5 from alpha 3 chain) [57366] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57367] (3 PDB entries) 
Domain d2knt__: 2knt - [44537]
Details for d2knt__
PDB Entry: 2knt (more details), 1.2 Å
PDB Description: the 1.2 angstrom structure of kunitz type domain c5
SCOP Domain Sequences for d2knt__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2knt__ g.8.1.1 (-) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens)}
etdicklpkdegtcrdfilkwyydpntkscarfwyggcggnenkfgsqkecekvcapv
SCOP Domain Coordinates for d2knt__:
Click to download the PDB-style file with coordinates for d2knt__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2knt__:
- d2knt__ appears in SCOP 1.57
- d2knt__ appears in the current release, SCOPe 2.08, called d2knta_
View in 3D