Lineage for d2hexc_ (2hex C:)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 203527Fold g.8: BPTI-like [57361] (1 superfamily)
  4. 203528Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 203529Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)
  6. 203564Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 203565Species Cow (Bos taurus) [TaxId:9913] [57365] (54 PDB entries)
  8. 203611Domain d2hexc_: 2hex C: [44504]

Details for d2hexc_

PDB Entry: 2hex (more details), 2.1 Å

PDB Description: decamers observed in the crystals of bovine pancreatic trypsin inhibitor

SCOP Domain Sequences for d2hexc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hexc_ g.8.1.1 (C:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus)}
rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcgg

SCOP Domain Coordinates for d2hexc_:

Click to download the PDB-style file with coordinates for d2hexc_.
(The format of our PDB-style files is described here.)

Timeline for d2hexc_: