Lineage for d3bthi_ (3bth I:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 143610Fold g.8: BPTI-like [57361] (1 superfamily)
  4. 143611Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 143612Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)
  6. 143647Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 143648Species Cow (Bos taurus) [TaxId:9913] [57365] (54 PDB entries)
  8. 143665Domain d3bthi_: 3bth I: [44479]
    Other proteins in same PDB: d3bthe_

Details for d3bthi_

PDB Entry: 3bth (more details), 1.75 Å

PDB Description: the crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti

SCOP Domain Sequences for d3bthi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bthi_ g.8.1.1 (I:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus)}
dfcleppytgpchariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga

SCOP Domain Coordinates for d3bthi_:

Click to download the PDB-style file with coordinates for d3bthi_.
(The format of our PDB-style files is described here.)

Timeline for d3bthi_:

143665
d3bthi_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d3bthe_