Lineage for d1cds__ (1cds -)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 428346Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 428347Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 428503Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (4 proteins)
  6. 428510Protein CD59 [57355] (1 species)
  7. 428511Species Human (Homo sapiens) [TaxId:9606] [57356] (5 PDB entries)
  8. 428514Domain d1cds__: 1cds - [44461]
    complexed with nag

Details for d1cds__

PDB Entry: 1cds (more details)

PDB Description: structure of a soluble, glycosylated form of the human complement regulatory protein cd59

SCOP Domain Sequences for d1cds__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cds__ g.7.1.3 (-) CD59 {Human (Homo sapiens)}
lqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenelt
yycckkdlcnfneqlen

SCOP Domain Coordinates for d1cds__:

Click to download the PDB-style file with coordinates for d1cds__.
(The format of our PDB-style files is described here.)

Timeline for d1cds__: