![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
![]() | Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
![]() | Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins) |
![]() | Protein CD59 [57355] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57356] (11 PDB entries) |
![]() | Domain d1cdsa_: 1cds A: [44461] |
PDB Entry: 1cds (more details)
SCOPe Domain Sequences for d1cdsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cdsa_ g.7.1.3 (A:) CD59 {Human (Homo sapiens) [TaxId: 9606]} lqcyncpnptadcktavncssdfdaclitkaglqvynkcwkfehcnfndvttrlrenelt yycckkdlcnfneqlen
Timeline for d1cdsa_: