Lineage for d2ccxa_ (2ccx A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032124Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 3032197Protein Cardiotoxin CTX IIB [57332] (1 species)
  7. 3032198Species Naja mossambica mossambica [TaxId:196380] [57333] (1 PDB entry)
  8. 3032199Domain d2ccxa_: 2ccx A: [44437]

Details for d2ccxa_

PDB Entry: 2ccx (more details)

PDB Description: determination of the nuclear magnetic resonance solution structure of cardiotoxin ctx iib from naja mossambica mossambica
PDB Compounds: (A:) cardiotoxin ctx iib

SCOPe Domain Sequences for d2ccxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ccxa_ g.7.1.1 (A:) Cardiotoxin CTX IIB {Naja mossambica mossambica [TaxId: 196380]}
lkcnqlippfwktcpkgknlcykmtmraapmvpvkrgcidvcpkssllikymccntnkcn

SCOPe Domain Coordinates for d2ccxa_:

Click to download the PDB-style file with coordinates for d2ccxa_.
(The format of our PDB-style files is described here.)

Timeline for d2ccxa_: