Lineage for d2ctx__ (2ctx -)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 269714Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulphide-rich fold: nearly all-beta
  4. 269715Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 269716Family g.7.1.1: Snake venom toxins [57303] (22 proteins)
  6. 269717Protein alpha-Cobratoxin [57318] (2 species)
  7. 269718Species Cobra (Naja naja siamensis) [57319] (2 PDB entries)
  8. 269719Domain d2ctx__: 2ctx - [44420]

Details for d2ctx__

PDB Entry: 2ctx (more details), 2.4 Å

PDB Description: the refined crystal structure of alpha-cobratoxin from naja naja siamensis at 2.4-angstroms resolution

SCOP Domain Sequences for d2ctx__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ctx__ g.7.1.1 (-) alpha-Cobratoxin {Cobra (Naja naja siamensis)}
ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
ncnpfptrkrp

SCOP Domain Coordinates for d2ctx__:

Click to download the PDB-style file with coordinates for d2ctx__.
(The format of our PDB-style files is described here.)

Timeline for d2ctx__: