Lineage for d1kxib_ (1kxi B:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2583547Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2583548Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2583549Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 2583662Protein Cardiotoxin V [57316] (1 species)
  7. 2583663Species Taiwan cobra (Naja naja atra) [TaxId:8656] [57317] (2 PDB entries)
  8. 2583665Domain d1kxib_: 1kxi B: [44418]

Details for d1kxib_

PDB Entry: 1kxi (more details), 2.19 Å

PDB Description: structure of cytotoxin homolog precursor
PDB Compounds: (B:) cardiotoxin v

SCOPe Domain Sequences for d1kxib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxib_ g.7.1.1 (B:) Cardiotoxin V {Taiwan cobra (Naja naja atra) [TaxId: 8656]}
lkchntqlpfiyktcpegknlcfkatlkkfplkfpvkrgcadncpknsallkyvccstdk
cn

SCOPe Domain Coordinates for d1kxib_:

Click to download the PDB-style file with coordinates for d1kxib_.
(The format of our PDB-style files is described here.)

Timeline for d1kxib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kxia_