Lineage for d3erab_ (3era B:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259038Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2259039Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2259040Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 2259173Protein Erabutoxin A [57310] (1 species)
  7. 2259174Species Broad-banded blue sea snake (Laticauda semifasciata) [TaxId:8631] [57311] (3 PDB entries)
  8. 2259176Domain d3erab_: 3era B: [44411]
    complexed with scn; mutant

Details for d3erab_

PDB Entry: 3era (more details), 1.7 Å

PDB Description: recombinant erabutoxin a (s8t mutant)
PDB Compounds: (B:) erabutoxin a

SCOPe Domain Sequences for d3erab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3erab_ g.7.1.1 (B:) Erabutoxin A {Broad-banded blue sea snake (Laticauda semifasciata) [TaxId: 8631]}
ricfnhqtsqpqttktcspgesscynkqwsdfrgtiiergcgcptvkpgiklsccesevc
nn

SCOPe Domain Coordinates for d3erab_:

Click to download the PDB-style file with coordinates for d3erab_.
(The format of our PDB-style files is described here.)

Timeline for d3erab_: