Lineage for d1qm7a_ (1qm7 A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1962063Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1962064Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1962065Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 1962212Protein Fasciculin [57308] (1 species)
    different isoforms
  7. 1962213Species Green mamba (Dendroaspis angusticeps) [TaxId:8618] [57309] (11 PDB entries)
  8. 1962224Domain d1qm7a_: 1qm7 A: [44405]
    engineered chimera with alpha-toxin

Details for d1qm7a_

PDB Entry: 1qm7 (more details), 2.1 Å

PDB Description: x-ray structure of a three-fingered chimeric protein, stability of a structural scaffold
PDB Compounds: (A:) r-chii

SCOPe Domain Sequences for d1qm7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qm7a_ g.7.1.1 (A:) Fasciculin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]}
tmcyshtttsrailtncpgetncykksrrhppkmvlgrgcgcptvapgiklnccttdkcn
y

SCOPe Domain Coordinates for d1qm7a_:

Click to download the PDB-style file with coordinates for d1qm7a_.
(The format of our PDB-style files is described here.)

Timeline for d1qm7a_: