Lineage for d1qm7a_ (1qm7 A:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 89158Fold g.7: Snake toxin-like [57301] (1 superfamily)
  4. 89159Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 89160Family g.7.1.1: Snake venom toxins [57303] (21 proteins)
  6. 89252Protein Fasciculin [57308] (1 species)
  7. 89253Species Green mamba (Dendroaspis angusticeps) [TaxId:8618] [57309] (7 PDB entries)
  8. 89260Domain d1qm7a_: 1qm7 A: [44405]

Details for d1qm7a_

PDB Entry: 1qm7 (more details), 2.1 Å

PDB Description: x-ray structure of a three-fingered chimeric protein, stability of a structural scaffold

SCOP Domain Sequences for d1qm7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qm7a_ g.7.1.1 (A:) Fasciculin {Green mamba (Dendroaspis angusticeps)}
tmcyshtttsrailtncpgetncykksrrhppkmvlgrgcgcptvapgiklnccttdkcn
y

SCOP Domain Coordinates for d1qm7a_:

Click to download the PDB-style file with coordinates for d1qm7a_.
(The format of our PDB-style files is described here.)

Timeline for d1qm7a_: