PDB entry 1qm7

View 1qm7 on RCSB PDB site
Description: x-ray structure of a three-fingered chimeric protein, stability of a structural scaffold
Deposited on 1999-09-21, released 2000-03-15
The last revision prior to the SCOP 1.57 freeze date was dated 2000-03-15, with a file datestamp of 2000-03-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.202
AEROSPACI score: -1.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1qm7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qm7A (A:)
    tmcyshtttsrailtncpgetncykksrrhppkmvlgrgcgcptvapgiklnccttdkcn
    y