Lineage for d1cxna_ (1cxn A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2259038Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2259039Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2259040Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 2259206Protein gamma-Cardiotoxin [57306] (1 species)
  7. 2259207Species Snake (Naja nigricollis) [TaxId:8654] [57307] (3 PDB entries)
  8. 2259211Domain d1cxna_: 1cxn A: [44401]

Details for d1cxna_

PDB Entry: 1cxn (more details)

PDB Description: refined three-dimensional solution structure of a snake cardiotoxin: analysis of the side-chain organisation suggests the existence of a possible phospholipid binding site
PDB Compounds: (A:) cardiotoxin gamma

SCOPe Domain Sequences for d1cxna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxna_ g.7.1.1 (A:) gamma-Cardiotoxin {Snake (Naja nigricollis) [TaxId: 8654]}
lkcnqlippfwktcpkgknlcykmtmraapmvpvkrgcidvcpkssllikymccntdkcn

SCOPe Domain Coordinates for d1cxna_:

Click to download the PDB-style file with coordinates for d1cxna_.
(The format of our PDB-style files is described here.)

Timeline for d1cxna_: