Lineage for d4hir__ (4hir -)
- Root: SCOP 1.67
Class g: Small proteins [56992] (72 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
Superfamily g.3.15: Leech antihemostatic proteins [57262] (2 families) 
Family g.3.15.2: Hirudin-like [57270] (3 proteins) Protein Hirudin [57271] (1 species) Species Leech (Hirudo medicinalis) [TaxId:6421] [57272] (8 PDB entries) 
Domain d4hir__: 4hir - [44374]
mutant
Details for d4hir__
PDB Entry: 4hir (more details)
PDB Description: solution structure of recombinant hirudin and the lys-47 (right arrow) glu mutant. a nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing study
SCOP Domain Sequences for d4hir__:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hir__ g.3.15.2 (-) Hirudin {Leech (Hirudo medicinalis)}
vvytdctesgqnlclcegsnvcgqgnkcilgsdgeknqcvtgegtpepq
SCOP Domain Coordinates for d4hir__:
Click to download the PDB-style file with coordinates for d4hir__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4hir__:
- d4hir__ first appeared (with stable ids) in SCOP 1.55
- d4hir__ appears in SCOP 1.65
- d4hir__ appears in SCOP 1.69
- d4hir__ appears in the current release, SCOPe 2.08, called d4hira_
View in 3D