Lineage for d4hira_ (4hir A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2583429Superfamily g.3.15: Leech antihemostatic proteins [57262] (3 families) (S)
  5. 2583451Family g.3.15.2: Hirudin-like [57270] (4 proteins)
  6. 2583460Protein Hirudin [57271] (1 species)
  7. 2583461Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [57272] (9 PDB entries)
  8. 2583469Domain d4hira_: 4hir A: [44374]
    mutant

Details for d4hira_

PDB Entry: 4hir (more details)

PDB Description: solution structure of recombinant hirudin and the lys-47 (right arrow) glu mutant. a nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing study
PDB Compounds: (A:) hirudin variant-1

SCOPe Domain Sequences for d4hira_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hira_ g.3.15.2 (A:) Hirudin {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
vvytdctesgqnlclcegsnvcgqgnkcilgsdgeknqcvtgegtpepq

SCOPe Domain Coordinates for d4hira_:

Click to download the PDB-style file with coordinates for d4hira_.
(The format of our PDB-style files is described here.)

Timeline for d4hira_: