| Class g: Small proteins [56992] (61 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies) disulphide-bound fold; contains beta-hairpin with two adjacent disulphides |
Superfamily g.3.11: EGF/Laminin [57196] (6 families) ![]() |
| Family g.3.11.1: EGF-type module [57197] (18 proteins) |
| Protein Plasminogen activator (tissue-type), t-PA [57231] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57232] (1 PDB entry) |
| Domain d1tpg_1: 1tpg 51-91 [44325] Other proteins in same PDB: d1tpg_2 mutant |
PDB Entry: 1tpg (more details)
SCOP Domain Sequences for d1tpg_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tpg_1 g.3.11.1 (51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens)}
cseprcfnggtcqqalyfsdfvcqcpegfagksceidtrat
Timeline for d1tpg_1: