Lineage for d1emna2 (1emn A:2167-2205)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2635894Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2636224Protein Fibrillin-1 [57227] (1 species)
    duplication: contains 47 EFG-like domains
  7. 2636225Species Human (Homo sapiens) [TaxId:9606] [57228] (7 PDB entries)
  8. 2636241Domain d1emna2: 1emn A:2167-2205 [44323]
    39th and 40th calcium-binding EGF-like domains
    complexed with ca

Details for d1emna2

PDB Entry: 1emn (more details)

PDB Description: nmr study of a pair of fibrillin ca2+ binding epidermal growth factor- like domains, minimized average structure
PDB Compounds: (A:) fibrillin

SCOPe Domain Sequences for d1emna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1emna2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]}
tdecsvgnpcgngtcknviggfectceegfepgpmmtce

SCOPe Domain Coordinates for d1emna2:

Click to download the PDB-style file with coordinates for d1emna2.
(The format of our PDB-style files is described here.)

Timeline for d1emna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1emna1