Lineage for d1dx5l2 (1dx5 L:388-422)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 202518Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 202990Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 202991Family g.3.11.1: EGF-type module [57197] (18 proteins)
  6. 203167Protein Thrombomodulin, different EGF-like domains [57225] (1 species)
  7. 203168Species Human (Homo sapiens) [TaxId:9606] [57226] (6 PDB entries)
  8. 203179Domain d1dx5l2: 1dx5 L:388-422 [44312]
    Other proteins in same PDB: d1dx5.1, d1dx5.2, d1dx5.3, d1dx5.4

Details for d1dx5l2

PDB Entry: 1dx5 (more details), 2.3 Å

PDB Description: crystal structure of the thrombin-thrombomodulin complex

SCOP Domain Sequences for d1dx5l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dx5l2 g.3.11.1 (L:388-422) Thrombomodulin, different EGF-like domains {Human (Homo sapiens)}
mfcnqtacpadcdpntqascecpegyilddgfict

SCOP Domain Coordinates for d1dx5l2:

Click to download the PDB-style file with coordinates for d1dx5l2.
(The format of our PDB-style files is described here.)

Timeline for d1dx5l2: