Lineage for d1hrf__ (1hrf -)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 142669Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 143091Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 143092Family g.3.11.1: EGF-type module [57197] (17 proteins)
  6. 143186Protein Heregulin-alpha, EGF-like domain [57223] (1 species)
  7. 143187Species Human (Homo sapiens) [TaxId:9606] [57224] (4 PDB entries)
  8. 143191Domain d1hrf__: 1hrf - [44301]

Details for d1hrf__

PDB Entry: 1hrf (more details)

PDB Description: solution structure of the epidermal growth factor-like domain of heregulin-alpha, a ligand for p180erb4

SCOP Domain Sequences for d1hrf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hrf__ g.3.11.1 (-) Heregulin-alpha, EGF-like domain {Human (Homo sapiens)}
gtshlvkcaekektfcvnggecfmvkdlsnpsrylckcqpgftgarctenvpmkvqnqek
aeelyqk

SCOP Domain Coordinates for d1hrf__:

Click to download the PDB-style file with coordinates for d1hrf__.
(The format of our PDB-style files is described here.)

Timeline for d1hrf__: