Lineage for d1urka1 (1urk A:6-49)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1961206Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1961207Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1961536Protein Plasminogen activator (urokinase-type) [57221] (1 species)
  7. 1961537Species Human (Homo sapiens) [TaxId:9606] [57222] (6 PDB entries)
  8. 1961549Domain d1urka1: 1urk A:6-49 [44297]
    Other proteins in same PDB: d1urka2
    complexed with fuc

Details for d1urka1

PDB Entry: 1urk (more details)

PDB Description: solution structure of the amino terminal fragment of urokinase-type plasminogen activator
PDB Compounds: (A:) plasminogen activator

SCOPe Domain Sequences for d1urka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urka1 g.3.11.1 (A:6-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}
qvpsncdclnggtcvsnkyfsnihwcncpkkfggqhceidkskt

SCOPe Domain Coordinates for d1urka1:

Click to download the PDB-style file with coordinates for d1urka1.
(The format of our PDB-style files is described here.)

Timeline for d1urka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1urka2