| Class g: Small proteins [56992] (92 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
| Family g.3.11.1: EGF-type module [57197] (23 proteins) |
| Protein Plasminogen activator (urokinase-type) [57221] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57222] (6 PDB entries) |
| Domain d1urka1: 1urk A:6-49 [44297] Other proteins in same PDB: d1urka2 complexed with fuc |
PDB Entry: 1urk (more details)
SCOPe Domain Sequences for d1urka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1urka1 g.3.11.1 (A:6-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}
qvpsncdclnggtcvsnkyfsnihwcncpkkfggqhceidkskt
Timeline for d1urka1: