PDB entry 1urk

View 1urk on RCSB PDB site
Description: solution structure of the amino terminal fragment of urokinase-type plasminogen activator
Class: plasminogen activation
Keywords: plasminogen activation
Deposited on 1994-01-10, released 1995-05-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: plasminogen activator
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00749 (0-129)
  Domains in SCOPe 2.05: d1urka1, d1urka2
• Heterogens: FUC

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1urkA (A:)
  qvpsncdclnggtcvsnkyfsnihwcncpkkfggqhceidksktcyegnghfyrgkastd
  tmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrrrpwcyvqvglkplvqe
  cmvhdcadgk