SCOPe 2.04: Domain d1egfa_: 1egf A:

Lineage for d1egfa_ (1egf A:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Epidermal growth factor, EGF [57215] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [57216] (8 PDB entries)

8. Domain d1egfa_: 1egf A: [44290]

Details for d1egfa_

PDB Entry: 1egf

PDB Description: solution structure of murine epidermal growth factor determined by nmr spectroscopy and refined by energy minimization with restraints

PDB Compounds: (A:) epidermal growth factor

SCOPe Domain Sequences for d1egfa_:

Sequence; same for both SEQRES and ATOM records:

>d1egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]}
nsypgcpssydgyclnggvcmhiesldsytcncvigysgdrcqtrdlrwwelr

Timeline for d1egfa_:

• d1egfa_ first appeared (with stable ids) in SCOP 1.55, called d1egf__
  
• d1egfa_ appears in SCOPe 2.03
  
• d1egfa_ appears in SCOPe 2.05
  
• d1egfa_ appears in the current release, SCOPe 2.08