Lineage for d1a3pa_ (1a3p A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2635894Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2636061Protein Epidermal growth factor, EGF [57215] (2 species)
  7. 2636070Species Mouse (Mus musculus) [TaxId:10090] [57216] (8 PDB entries)
  8. 2636075Domain d1a3pa_: 1a3p A: [44284]

Details for d1a3pa_

PDB Entry: 1a3p (more details)

PDB Description: role of the 6-20 disulfide bridge in the structure and activity of epidermal growth factor, nmr, 20 structures
PDB Compounds: (A:) epidermal growth factor

SCOPe Domain Sequences for d1a3pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a3pa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]}
pgapssydgyclnggvamhiesldsytcncvigysgdrcqtrdlr

SCOPe Domain Coordinates for d1a3pa_:

Click to download the PDB-style file with coordinates for d1a3pa_.
(The format of our PDB-style files is described here.)

Timeline for d1a3pa_: