Lineage for d5coxd2 (5cox D:33-73)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 88440Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 88834Superfamily g.3.11: EGF/Laminin [57196] (5 families) (S)
  5. 88835Family g.3.11.1: EGF-type module [57197] (17 proteins)
  6. 88938Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
  7. 88939Species Mouse (Mus musculus) [TaxId:10090] [57212] (7 PDB entries)
  8. 88963Domain d5coxd2: 5cox D:33-73 [44282]
    Other proteins in same PDB: d5coxa1, d5coxb1, d5coxc1, d5coxd1

Details for d5coxd2

PDB Entry: 5cox (more details), 3 Å

PDB Description: uninhibited mouse cyclooxygenase-2 (prostaglandin synthase-2)

SCOP Domain Sequences for d5coxd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5coxd2 g.3.11.1 (D:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus)}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

SCOP Domain Coordinates for d5coxd2:

Click to download the PDB-style file with coordinates for d5coxd2.
(The format of our PDB-style files is described here.)

Timeline for d5coxd2:

88963
d5coxd2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d5coxd1