Lineage for d3pghc2 (3pgh C:33-73)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 202518Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 202990Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 202991Family g.3.11.1: EGF-type module [57197] (18 proteins)
  6. 203116Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
  7. 203117Species Mouse (Mus musculus) [TaxId:10090] [57212] (7 PDB entries)
  8. 203130Domain d3pghc2: 3pgh C:33-73 [44271]
    Other proteins in same PDB: d3pgha1, d3pghb1, d3pghc1, d3pghd1

Details for d3pghc2

PDB Entry: 3pgh (more details), 3 Å

PDB Description: cyclooxygenase-2 (prostaglandin synthase-2) complexed with a non- selective inhibitor, flurbiprofen

SCOP Domain Sequences for d3pghc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pghc2 g.3.11.1 (C:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus)}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

SCOP Domain Coordinates for d3pghc2:

Click to download the PDB-style file with coordinates for d3pghc2.
(The format of our PDB-style files is described here.)

Timeline for d3pghc2: