Class g: Small proteins [56992] (85 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) |
Family g.3.11.1: EGF-type module [57197] (22 proteins) |
Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species) the rest of protein is heme-linked peroxidase, all-alpha fold |
Species Mouse (Mus musculus) [TaxId:10090] [57212] (8 PDB entries) |
Domain d1cx2d2: 1cx2 D:33-73 [44264] Other proteins in same PDB: d1cx2a1, d1cx2b1, d1cx2c1, d1cx2d1 complexed with hem, nag, s58 |
PDB Entry: 1cx2 (more details), 3 Å
SCOP Domain Sequences for d1cx2d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cx2d2 g.3.11.1 (D:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe
Timeline for d1cx2d2: