Lineage for d1cx2d2 (1cx2 D:33-73)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39963Superfamily g.3.11: EGF/Laminin [57196] (4 families) (S)
  5. 39964Family g.3.11.1: EGF-type module [57197] (16 proteins)
  6. 40056Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
  7. 40057Species Mouse (Mus musculus) [TaxId:10090] [57212] (7 PDB entries)
  8. 40063Domain d1cx2d2: 1cx2 D:33-73 [44264]
    Other proteins in same PDB: d1cx2a1, d1cx2b1, d1cx2c1, d1cx2d1

Details for d1cx2d2

PDB Entry: 1cx2 (more details), 3 Å

PDB Description: cyclooxygenase-2 (prostaglandin synthase-2) complexed with a selective inhibitor, sc-558

SCOP Domain Sequences for d1cx2d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cx2d2 g.3.11.1 (D:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus)}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

SCOP Domain Coordinates for d1cx2d2:

Click to download the PDB-style file with coordinates for d1cx2d2.
(The format of our PDB-style files is described here.)

Timeline for d1cx2d2: