Lineage for d1ebva2 (1ebv A:33-73)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 268805Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
    disulphide-bound fold; contains beta-hairpin with two adjacent disulphides
  4. 269314Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 269315Family g.3.11.1: EGF-type module [57197] (18 proteins)
  6. 269454Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
    the rest of protein is heme-linked peroxidase, all-alpha fold
  7. 269480Species Sheep (Ovis aries) [TaxId:9940] [57211] (15 PDB entries)
  8. 269493Domain d1ebva2: 1ebv A:33-73 [44252]
    Other proteins in same PDB: d1ebva1
    complexed with hem, nag, scl

Details for d1ebva2

PDB Entry: 1ebv (more details), 3.2 Å

PDB Description: ovine pghs-1 complexed with salicyl hydroxamic acid

SCOP Domain Sequences for d1ebva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebva2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries)}
vnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

SCOP Domain Coordinates for d1ebva2:

Click to download the PDB-style file with coordinates for d1ebva2.
(The format of our PDB-style files is described here.)

Timeline for d1ebva2:

269493
d1ebva2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1ebva1