Lineage for d1ccf__ (1ccf -)
- Root: SCOP 1.59
Class g: Small proteins [56992] (58 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies) 
Superfamily g.3.11: EGF/Laminin [57196] (6 families) 
Family g.3.11.1: EGF-type module [57197] (17 proteins) 
Protein Factor X, N-terminal module [57205] (2 species) 
Species Cow (Bos taurus) [TaxId:9913] [57207] (5 PDB entries) 
Domain d1ccf__: 1ccf - [44241]
Details for d1ccf__
PDB Entry: 1ccf (more details)
PDB Description: how an epidermal growth factor (egf)-like domain binds calcium-high resolution nmr structure of the calcium form of the nh2-terminal egf- like domain in coagulation factor x
SCOP Domain Sequences for d1ccf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ccf__ g.3.11.1 (-) Factor X, N-terminal module {Cow (Bos taurus)}
kdgdqceghpclnqghckdgigdytctcaegfegkncefstr
SCOP Domain Coordinates for d1ccf__:
Click to download the PDB-style file with coordinates for d1ccf__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ccf__:
- d1ccf__ first appeared (with stable ids) in SCOP 1.55
- d1ccf__ appears in SCOP 1.57
- d1ccf__ appears in SCOP 1.61
- d1ccf__ appears in the current release, SCOPe 2.08, called d1ccfa_
View in 3D