Lineage for d1fakl1 (1fak L:49-86)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 142669Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 143091Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 143092Family g.3.11.1: EGF-type module [57197] (17 proteins)
  6. 143097Protein Coagulation factor VIIa [57201] (1 species)
  7. 143098Species Human (Homo sapiens) [TaxId:9606] [57202] (11 PDB entries)
  8. 143103Domain d1fakl1: 1fak L:49-86 [44212]
    Other proteins in same PDB: d1fakh_, d1faki_, d1fakl3, d1fakt1, d1fakt2

Details for d1fakl1

PDB Entry: 1fak (more details), 2.1 Å

PDB Description: human tissue factor complexed with coagulation factor viia inhibited with a bpti-mutant

SCOP Domain Sequences for d1fakl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fakl1 g.3.11.1 (L:49-86) Coagulation factor VIIa {Human (Homo sapiens)}
qcasspcqnggsckdqlqsyicfclpafegrncethkd

SCOP Domain Coordinates for d1fakl1:

Click to download the PDB-style file with coordinates for d1fakl1.
(The format of our PDB-style files is described here.)

Timeline for d1fakl1: