Lineage for d1bkt__ (1bkt -)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 142669Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 142888Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) (S)
  5. 142941Family g.3.7.2: Short-chain scorpion toxins [57116] (22 proteins)
  6. 142950Protein Bmktx [57119] (1 species)
  7. 142951Species Buthus martensii [TaxId:34649] [57120] (1 PDB entry)
  8. 142952Domain d1bkt__: 1bkt - [44146]

Details for d1bkt__

PDB Entry: 1bkt (more details)

PDB Description: bmktx toxin from scorpion buthus martensii karsch, nmr, 25 structures

SCOP Domain Sequences for d1bkt__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bkt__ g.3.7.2 (-) Bmktx {Buthus martensii}
vginvkckhsgqclkpckdagmrfgkcingkcdctpk

SCOP Domain Coordinates for d1bkt__:

Click to download the PDB-style file with coordinates for d1bkt__.
(The format of our PDB-style files is described here.)

Timeline for d1bkt__: