Lineage for d4cpai_ (4cpa I:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 142669Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 142747Superfamily g.3.2: Plant inhibitors of proteinases and amylases [57027] (1 family) (S)
  5. 142748Family g.3.2.1: Plant inhibitors of proteinases and amylases [57028] (3 proteins)
  6. 142754Protein Carboxypeptidase A inhibitor [57034] (1 species)
  7. 142755Species Potato [TaxId:4113] [57035] (1 PDB entry)
  8. 142756Domain d4cpai_: 4cpa I: [44074]
    Other proteins in same PDB: d4cpa__

Details for d4cpai_

PDB Entry: 4cpa (more details), 2.5 Å

PDB Description: refined crystal structure of the potato inhibitor complex of carboxypeptidase a at 2.5 angstroms resolution

SCOP Domain Sequences for d4cpai_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cpai_ g.3.2.1 (I:) Carboxypeptidase A inhibitor {Potato}
zhadpicnkpckthddcsgawfcqacwnsartcgpyv

SCOP Domain Coordinates for d4cpai_:

Click to download the PDB-style file with coordinates for d4cpai_.
(The format of our PDB-style files is described here.)

Timeline for d4cpai_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4cpa__