Lineage for d2cwgb4 (2cwg B:130-171)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 202518Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 202519Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (2 families) (S)
  5. 202520Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (3 proteins)
  6. 202542Protein Wheat germ agglutinin (WGA) [57018] (1 species)
  7. 202543Species Wheat (Triticum vulgaris, also Triticum aestivum) [57019] (9 PDB entries)
  8. 202567Domain d2cwgb4: 2cwg B:130-171 [44031]

Details for d2cwgb4

PDB Entry: 2cwg (more details), 2 Å

PDB Description: crystallographic refinement and structure analysis of the complex of wheat germ agglutinin with a bivalent sialoglycopeptide from glycophorin a

SCOP Domain Sequences for d2cwgb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwgb4 g.3.1.1 (B:130-171) Wheat germ agglutinin (WGA) {Wheat (Triticum vulgaris, also Triticum aestivum)}
kpcgkdaggrvctnnyccskwgscgigpgycgagcqsggcdg

SCOP Domain Coordinates for d2cwgb4:

Click to download the PDB-style file with coordinates for d2cwgb4.
(The format of our PDB-style files is described here.)

Timeline for d2cwgb4: