Lineage for d9wgab1 (9wga B:1-52)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 202518Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 202519Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (2 families) (S)
  5. 202520Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (3 proteins)
  6. 202542Protein Wheat germ agglutinin (WGA) [57018] (1 species)
  7. 202543Species Wheat (Triticum vulgaris, also Triticum aestivum) [57019] (9 PDB entries)
  8. 202548Domain d9wgab1: 9wga B:1-52 [44004]

Details for d9wgab1

PDB Entry: 9wga (more details), 1.8 Å

PDB Description: 2.2 angstroms resolution structure analysis of two refined n- acetylneuraminyllactose-wheat germ agglutinin isolectin complexes

SCOP Domain Sequences for d9wgab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d9wgab1 g.3.1.1 (B:1-52) Wheat germ agglutinin (WGA) {Wheat (Triticum vulgaris, also Triticum aestivum)}
ercgeqgsnmecpnnlccsqygycgmggdycgkgcqngacwtskrcgsqagg

SCOP Domain Coordinates for d9wgab1:

Click to download the PDB-style file with coordinates for d9wgab1.
(The format of our PDB-style files is described here.)

Timeline for d9wgab1: